HPA023755

PPP1R16A antibody from MilliporeSigma / Merck KGaA
MGC14333, MYPT3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023755
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023755, RRID:AB_1854268
Product name
Anti-PPP1R16A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023755
Antibody type
Polyclonal
Antigen
Protein phosphatase 1 regulatory subunit 16A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLK
QVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLA
NE
Storage
-20C
Provider Type Product Number
- No reagents -