HPA004747

FLNB antibody from Atlas Antibodies
ABP-278, FH1, FLN1L, LRS1, TABP, TAP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004747
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004747, RRID:AB_1848599
Product name
Anti-FLNB
Provider product page
Atlas Antibodies - HPA004747
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNP
DLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPL
KIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIK
HTIAVVWG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -