Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005495-M01 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005495-M01, RRID:AB_425608
- Product name
- PPM1B monoclonal antibody (M01), clone 1A3-2A4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PPM1B.
- Antigen sequence
- MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEE
 IMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLA
 GKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKL
 VEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEE
 SPAEPAATATSSNSDAGNPVTMQESHTESESGLAE
 LDSSNEDAGTKMSGEKI
- Isotype
- IgG
- Antibody clone number
- 1A3-2A4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Western Blot analysis of PPM1B expression in transfected 293T cell line by PPM1B monoclonal antibody (M01), clone 1A3-2A4.Lane 1: PPM1B transfected lysate(52.643 KDa).Lane 2: Non-transfected lysate.
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Detection limit for recombinant GST tagged PPM1B is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunofluorescence of monoclonal antibody to PPM1B on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunoprecipitation of PPM1B transfected lysate using anti-PPM1B monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PPM1B monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between ARRB2 and PPM1B. HeLa cells were stained with anti-ARRB2 rabbit purified polyclonal 1:1200 and anti-PPM1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)