HPA016745

PPM1B antibody from Sigma-Aldrich
PP2CB, PP2CBETA, PPC2BETAX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016745
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016745, RRID:AB_1855622
Product name
Anti-PPM1B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016745
Antibody type
Polyclonal
Antigen
Protein phosphatase 1B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLV
EALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEES
PAEPAATATSSNSDAGNPVTMQESHTESESGLAEL
Storage
-20C
Provider Type Product Number
- No reagents -