H00001958-M03
antibody from Abnova Corporation
Targeting: EGR1
AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001958-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001958-M03, RRID:AB_534849
- Product name
- EGR1 monoclonal antibody (M03), clone 6E8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EGR1.
- Antigen sequence
SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPG
SSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSF
PSSAVTNSFSASTGLSDMTATFSPRTIEIC- Isotype
- IgG
- Antibody clone number
- 6E8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Induction of hypertrophy in vitro by mechanical loading in adult rabbit myocardium.
Bupha-Intr T, Holmes JW, Janssen PM
American journal of physiology. Heart and circulatory physiology 2007 Dec;293(6):H3759-67
American journal of physiology. Heart and circulatory physiology 2007 Dec;293(6):H3759-67
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of EGR1 expression in transfected 293T cell line by EGR1 monoclonal antibody (M03), clone 6E8.Lane 1: EGR1 transfected lysate(59.73 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EGR1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to EGR1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to EGR1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol