HPA004723

ITGAX antibody from Sigma-Aldrich
CD11C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004723
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004723, RRID:AB_1846231
Product name
Anti-ITGAX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004723
Antibody type
Polyclonal
Antigen
Integrin alpha-X precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPA
EIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNL
LGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSL
SRVRV
Storage
-20C
Provider Type Product Number
- No reagents -