Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310307 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Isocitrate Dehydrogenase 3 (NAD+) alpha (IDH3A) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IDH3A antibody: synthetic peptide directed towards the N terminal of human IDH3A
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAK
ESMDK NKMGLKGPLK- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Loss of the respiratory enzyme citrate synthase directly links the Warburg effect to tumor malignancy.
Evaluation by mutagenesis of the importance of 3 arginines in alpha, beta, and gamma subunits of human NAD-dependent isocitrate dehydrogenase.
Lin CC, Cheng TL, Tsai WH, Tsai HJ, Hu KH, Chang HC, Yeh CW, Chen YC, Liao CC, Chang WT
Scientific reports 2012;2:785
Scientific reports 2012;2:785
Evaluation by mutagenesis of the importance of 3 arginines in alpha, beta, and gamma subunits of human NAD-dependent isocitrate dehydrogenase.
Soundar S, Park JH, Huh TL, Colman RF
The Journal of biological chemistry 2003 Dec 26;278(52):52146-53
The Journal of biological chemistry 2003 Dec 26;278(52):52146-53
No comments: Submit comment
No validations: Submit validation data