HPA024187

HESX1 antibody from Sigma-Aldrich
ANF, RPX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024187
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024187, RRID:AB_1850620
Product name
Anti-HESX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024187
Antibody type
Polyclonal
Antigen
Homeobox expressed in ES cells 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRP
WADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPM
PEERASKYENYFSASERLSLKRELSWYRGRRPRTA
FTQNQIEVLENVFRVNCYPG
Storage
-20C
Provider Type Product Number
- No reagents -