HPA000992

GOLGA5 antibody from Atlas Antibodies
golgin-84, GOLIM5, ret-II, rfg5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000992
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000992, RRID:AB_1079009
Product name
Anti-GOLGA5
Provider product page
Atlas Antibodies - HPA000992
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEG
QEESSKENVSSNAACPDHTPTPNDDGKSHELSNLR
LENQLLRNEVQSLNQEMASLLQRSKETQEELNKAR
ARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKD
SQLAVLKV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -