Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [14]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000992 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000992, RRID:AB_1079009
- Product name
- Anti-GOLGA5
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEG
QEESSKENVSSNAACPDHTPTPNDDGKSHELSNLR
LENQLLRNEVQSLNQEMASLLQRSKETQEELNKAR
ARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKD
SQLAVLKV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The specificity of vesicle traffic to the Golgi is encoded in the golgin coiled-coil proteins
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Multiple domains in the Crumbs Homolog 2a (Crb2a) protein are required for regulating rod photoreceptor size.
Systematically generated antibodies against human gene products: High throughput screening on sections from the rat nervous system
Wong M, Munro S
Science 2014 October;346(6209):1256898-1256898
Science 2014 October;346(6209):1256898-1256898
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E
Journal of Proteomics 2012 April;75(7):2236-2251
Journal of Proteomics 2012 April;75(7):2236-2251
Multiple domains in the Crumbs Homolog 2a (Crb2a) protein are required for regulating rod photoreceptor size.
Hsu YC, Jensen AM
BMC cell biology 2010 Jul 29;11:60
BMC cell biology 2010 Jul 29;11:60
Systematically generated antibodies against human gene products: High throughput screening on sections from the rat nervous system
Mulder J, Wernérus H, Shi T, Pontén F, Hober S, Uhlén M, Hökfelt T
Neuroscience 2007 June;146(4):1689-1703
Neuroscience 2007 June;146(4):1689-1703
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GOLGA5 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, kidney, liver and testis using Anti-GOLGA5 antibody HPA000992 (A) shows similar protein distribution across tissues to independent antibody HPA063876 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong granular positivity in cytoplasm of glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse globus pallidus shows positivity in neuronal cell bodies.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows granular cytoplasmic immunoreactivity in neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse motor cortex shows strong cytoplasmic immunoreactivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse thalamus shows positivity in neuronal cell bodies in ventral anterior nucleus.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse hippocampus shows immunoreactivity in a subset of neurons in the CA3 area.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse mesencephalic reticular formation shows strong immunoreactivity in a subset of neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cell bodies.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows moderate granular immunoreactivity in neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-GOLGA5 antibody HPA000992.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-GOLGA5 antibody HPA000992.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-GOLGA5 antibody HPA000992.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-GOLGA5 antibody HPA000992.
- Sample type
- HUMAN