HPA000992

GOLGA5 antibody from Sigma-Aldrich
golgin-84, GOLIM5, ret-II, rfg5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000992
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000992, RRID:AB_1079009
Product name
Anti-GOLGA5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000992
Antibody type
Polyclonal
Antigen
Golgin subfamily A member 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEG
QEESSKENVSSNAACPDHTPTPNDDGKSHELSNLR
LENQLLRNEVQSLNQEMASLLQRSKETQEELNKAR
ARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKD
SQLAVLKV
Storage
-20C
Provider Type Product Number
- No reagents -