HPA002928

CEBPE antibody from Sigma-Aldrich
CRP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002928
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002928, RRID:AB_1078494
Product name
Anti-CEBPE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002928
Antibody type
Polyclonal
Antigen
CCAAT/enhancer-binding protein epsilon recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEH
EASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKG
PGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGI
YSSPGSYDPRAVAVKEEPR
Storage
-20C
Provider Type Product Number
- No reagents -