HPA008877

ITGB2 antibody from Atlas Antibodies
CD18, LFA-1, MAC-1, MFI7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008877
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008877, RRID:AB_1846256
Product name
Anti-ITGB2
Provider product page
Atlas Antibodies - HPA008877
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDS
IRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGG
QKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDL
YYLMDLSYSML
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -