HPA008877

ITGB2 antibody from Sigma-Aldrich
CD18, LFA-1, MAC-1, MFI7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008877
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008877, RRID:AB_1846256
Product name
Anti-ITGB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008877
Antibody type
Polyclonal
Antigen
Integrin beta-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDS
IRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGG
QKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDL
YYLMDLSYSML
Storage
-20C
Provider Type Product Number
- No reagents -