HPA016894

ITGB2 antibody from MilliporeSigma / Merck KGaA
CD18, LFA-1, MAC-1, MFI7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016894
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA016894, RRID:AB_1846257
Product name
Anti-ITGB2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA016894
Antibody type
Polyclonal
Antigen
Integrin beta-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAV
TSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIK
NAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGV
Storage
-20C
Provider Type Product Number
- No reagents -