HPA020853

ZNF250 antibody from MilliporeSigma / Merck KGaA
MGC9718, ZFP647, ZNF647
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020853
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA020853, RRID:AB_1859152
Product name
Anti-ZNF250 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA020853
Antibody type
Polyclonal
Antigen
Zinc finger protein 250 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPKPLISEQTVILGKTPLGRIDQENNETKQSFCLS
PNSVDHREVQVLSQSMPLTPHQAVPSGERPYMCVE
CGKCFGRSSH
Storage
-20C
Provider Type Product Number
- No reagents -