HPA020082

CCDC146 antibody from Sigma-Aldrich
KIAA1505
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020082
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020082, RRID:AB_1852410
Product name
Anti-CCDC146 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020082
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 146 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELSMKQALTIELQKEVREKEDFIFTCNSRIEKGLP
LNKEIEKEWLKVLRDEEMHALAIAEKSQEFLEADN
RQLPNGVYTTAEQRPNAYIPEADATLPLPKPYGAL
APFKPSEPGANMRHIRKPVIKPVEI
Storage
-20C
Provider Type Product Number
- No reagents -