HPA017087

SDC3 antibody from MilliporeSigma / Merck KGaA
N-syndecan, SYND3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017087
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017087, RRID:AB_1857706
Product name
Anti-SDC3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017087
Antibody type
Polyclonal
Antigen
Syndecan-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPRLVSTATSRPRALPRPATTQEPDIPERSTLPLG
TTAPGPTEVAQTPTPETFLTTIRDEPEVPVSGGPS
GDFELPEEETTQPDTANEVVAVGGAAAKASSPPGT
LPKGARPGPGLLDNAIDSGSSAAQLPQKSILERK
Storage
-20C
Provider Type Product Number
- No reagents -