Antibody data
- Antibody Data
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [13]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA026682
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA026682, RRID:AB_1848533
- Product name
- Anti-FGL2
- Provider product page
- Atlas Antibodies - HPA026682
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVT
PDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFT
RTWQDYKAGFGNLRR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No references: Submit reference
No comments: Submit comment
Supportive validation
Enhanced validation
Enhanced validation
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-FGL2 antibody HPA026682.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human spleen using Anti-FGL2 antibody HPA026682.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-FGL2 antibody. Corresponding FGL2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human spleen and pancreas tissues using HPA026682 antibody. Corresponding FGL2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human liver, lymph node, skeletal muscle and spleen using Anti-FGL2 antibody HPA026682 (A) shows similar protein distribution across tissues to independent antibody HPA021011 (B).
- Sample type
- HUMAN
- Antibody #2 product nr
- HPA021011
- Antibody provider
- Atlas Antibodies
- Independent Antibody Method
- ANTIBODY
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum, lymph node, skeletal muscle and spleen using Anti-FGL2 antibody HPA026682 (A) shows similar protein distribution across tissues to independent antibody HPA021011 (B).
- Antibody #2 product nr
- HPA021011
- Antibody provider
- Atlas Antibodies