HPA026682

FGL2 antibody from Atlas Antibodies
pT49, T49

Antibody data

Product number
HPA026682
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026682, RRID:AB_1848533
Product name
Anti-FGL2
Provider product page
Atlas Antibodies - HPA026682
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVT
PDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFT
RTWQDYKAGFGNLRR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.