Antibody data
- Antibody Data
- Antigen structure
- References [11]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010875-M01 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010875-M01, RRID:AB_565732
- Product name
- FGL2 monoclonal antibody (M01), clone 6D9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FGL2.
- Antigen sequence
- NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQ
 VSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLK
 KSCQDCKLQADDNGDPGRNGLLLPSTGAPG
- Isotype
- IgG
- Antibody clone number
- 6D9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references		Sodium tanshinone IIA sulfonate ameliorates experimental coronary no-reflow phenomenon through down-regulation of FGL2.
				
Novel antibody against a glutamic acid-rich human fibrinogen-like protein 2-derived peptide near Ser91 inhibits hfgl2 prothrombinase activity.
				
Soluble FGL2, a novel effector molecule of activated hepatic stellate cells, regulates T-cell function in cirrhotic patients with hepatocellular carcinoma.
				
C5a/C5aR pathway is essential for the pathogenesis of murine viral fulminant hepatitis by way of potentiating Fgl2/fibroleukin expression.
				
Correlation of fibrinogen-like protein 2 with disease progression in patients with severe acute pancreatitis.
				
Intestinal and peripheral fibrinogen-like protein 2 expression in inflammatory bowel disease.
				
Combined adenovirus-mediated artificial microRNAs targeting mfgl2, mFas, and mTNFR1 protect against fulminant hepatic failure in mice.
				
FGL2/fibroleukin mediates hepatic reperfusion injury by induction of sinusoidal endothelial cell and hepatocyte apoptosis in mice.
				
The FGL2/fibroleukin prothrombinase is involved in alveolar macrophage activation in COPD through the MAPK pathway.
				
Expression of prothrombin and protease activated receptors in human myometrium during pregnancy and labor.
				
Targeted deletion of fgl2 leads to impaired regulatory T cell activity and development of autoimmune glomerulonephritis.
				
		
	
			Long R, You Y, Li W, Jin N, Huang S, Li T, Liu K, Wang Z
Life sciences 2015 Dec 1;142:8-18
		Life sciences 2015 Dec 1;142:8-18
Novel antibody against a glutamic acid-rich human fibrinogen-like protein 2-derived peptide near Ser91 inhibits hfgl2 prothrombinase activity.
			Li WZ, Wang J, Long R, Su GH, Bukhory DK, Dai J, Jin N, Huang SY, Jia P, Li T, Fan C, Liu K, Wang Z
PloS one 2014;9(4):e94551
		PloS one 2014;9(4):e94551
Soluble FGL2, a novel effector molecule of activated hepatic stellate cells, regulates T-cell function in cirrhotic patients with hepatocellular carcinoma.
			Sun Y, Xi D, Ding W, Wang F, Zhou H, Ning Q
Hepatology international 2014 Oct;8(4):567-75
		Hepatology international 2014 Oct;8(4):567-75
C5a/C5aR pathway is essential for the pathogenesis of murine viral fulminant hepatitis by way of potentiating Fgl2/fibroleukin expression.
			Xu GL, Chen J, Yang F, Li GQ, Zheng LX, Wu YZ
Hepatology (Baltimore, Md.) 2014 Jul;60(1):114-24
		Hepatology (Baltimore, Md.) 2014 Jul;60(1):114-24
Correlation of fibrinogen-like protein 2 with disease progression in patients with severe acute pancreatitis.
			Ye X, Huai J, Chen R, Ding J, Chen Y, Cai Z
Experimental and therapeutic medicine 2014 Jan;7(1):85-89
		Experimental and therapeutic medicine 2014 Jan;7(1):85-89
Intestinal and peripheral fibrinogen-like protein 2 expression in inflammatory bowel disease.
			Dong X, Ye X, Chen X, Chen T, Xie S, Li Q, Lin X, Huang Z
Digestive diseases and sciences 2014 Apr;59(4):769-77
		Digestive diseases and sciences 2014 Apr;59(4):769-77
Combined adenovirus-mediated artificial microRNAs targeting mfgl2, mFas, and mTNFR1 protect against fulminant hepatic failure in mice.
			Xi D, Wang M, Ye H, Luo X, Ning Q
PloS one 2013;8(11):e82330
		PloS one 2013;8(11):e82330
FGL2/fibroleukin mediates hepatic reperfusion injury by induction of sinusoidal endothelial cell and hepatocyte apoptosis in mice.
			Selzner N, Liu H, Boehnert MU, Adeyi OA, Shalev I, Bartczak AM, Xue-Zhong M, Manuel J, Rotstein OD, McGilvray ID, Grant DR, Phillips MJ, Levy GA, Selzner M
Journal of hepatology 2012 Jan;56(1):153-9
		Journal of hepatology 2012 Jan;56(1):153-9
The FGL2/fibroleukin prothrombinase is involved in alveolar macrophage activation in COPD through the MAPK pathway.
			Liu Y, Xu S, Xiao F, Xiong Y, Wang X, Gao S, Yan W, Ning Q
Biochemical and biophysical research communications 2010 May 28;396(2):555-61
		Biochemical and biophysical research communications 2010 May 28;396(2):555-61
Expression of prothrombin and protease activated receptors in human myometrium during pregnancy and labor.
			O'Brien M, Morrison JJ, Smith TJ
Biology of reproduction 2008 Jan;78(1):20-6
		Biology of reproduction 2008 Jan;78(1):20-6
Targeted deletion of fgl2 leads to impaired regulatory T cell activity and development of autoimmune glomerulonephritis.
			Shalev I, Liu H, Koscik C, Bartczak A, Javadi M, Wong KM, Maknojia A, He W, Liu MF, Diao J, Winter E, Manuel J, McCarthy D, Cattral M, Gommerman J, Clark DA, Phillips MJ, Gorczynski RR, Zhang L, Downey G, Grant D, Cybulsky MI, Levy G
Journal of immunology (Baltimore, Md. : 1950) 2008 Jan 1;180(1):249-60
		Journal of immunology (Baltimore, Md. : 1950) 2008 Jan 1;180(1):249-60
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Western Blot analysis of FGL2 expression in transfected 293T cell line by FGL2 monoclonal antibody (M01), clone 6D9.Lane 1: FGL2 transfected lysate(50 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- FGL2 monoclonal antibody (M01), clone 6D9. Western Blot analysis of FGL2 expression in Raw 264.7 ( Cat # L024V1 ).
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Detection limit for recombinant GST tagged FGL2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunoprecipitation of FGL2 transfected lysate using anti-FGL2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FGL2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunoperoxidase of monoclonal antibody to FGL2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol