Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310296 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ITGBL1 antibody: synthetic peptide directed towards the N terminal of human ITGBL1
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSW
PGAAC RLSRAESERR- Vial size
- 0.1 mg
Submitted references Genetic and physiological data implicating the new human gene G72 and the gene for D-amino acid oxidase in schizophrenia.
Chumakov I, Blumenfeld M, Guerassimenko O, Cavarec L, Palicio M, Abderrahim H, Bougueleret L, Barry C, Tanaka H, La Rosa P, Puech A, Tahri N, Cohen-Akenine A, Delabrosse S, Lissarrague S, Picard FP, Maurice K, Essioux L, Millasseau P, Grel P, Debailleul V, Simon AM, Caterina D, Dufaure I, Malekzadeh K, Belova M, Luan JJ, Bouillot M, Sambucy JL, Primas G, Saumier M, Boubkiri N, Martin-Saumier S, Nasroune M, Peixoto H, Delaye A, Pinchot V, Bastucci M, Guillou S, Chevillon M, Sainz-Fuertes R, Meguenni S, Aurich-Costa J, Cherif D, Gimalac A, Van Duijn C, Gauvreau D, Ouellette G, Fortier I, Raelson J, Sherbatich T, Riazanskaia N, Rogaev E, Raeymaekers P, Aerssens J, Konings F, Luyten W, Macciardi F, Sham PC, Straub RE, Weinberger DR, Cohen N, Cohen D
Proceedings of the National Academy of Sciences of the United States of America 2002 Oct 15;99(21):13675-80
Proceedings of the National Academy of Sciences of the United States of America 2002 Oct 15;99(21):13675-80
No comments: Submit comment
No validations: Submit validation data