HPA005676

ITGBL1 antibody from Sigma-Aldrich
OSCP, TIED
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005676
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005676, RRID:AB_1851948
Product name
Anti-ITGBL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005676
Antibody type
Polyclonal
Antigen
Integrin beta-like protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVY
DRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQS
CTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYP
PGDRRVYGKTCECDDRRCEDLDGV
Storage
-20C
Provider Type Product Number
- No reagents -