HPA020058

GSAP antibody from MilliporeSigma / Merck KGaA
LOC54103, PION
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020058
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA020058, RRID:AB_2164411
Product name
Anti-PION antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA020058
Antibody type
Polyclonal
Antigen
Protein pigeon homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HPMSSNIISRNHVTRLLQNYKKQPRNSMINKSSFS
VEFLPLNYFIEILTDIESSNQALYPFEGHDNVDAE
FV
Storage
-20C
Provider Type Product Number
- No reagents -