Antibody data

Product number
H00010094-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010094-M06, RRID:AB_1571395
Product name
ARPC3 monoclonal antibody (M06), clone 2E11
Provider product page
Abnova Corporation - H00010094-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ARPC3.
Antigen sequence
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRE
TKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIY
ITLYISEC
Isotype
IgG
Antibody clone number
2E11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -