HPA006550

ARPC3 antibody from Atlas Antibodies
ARC21, p21-Arc
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006550
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006550, RRID:AB_1854869
Product name
Anti-ARPC3
Provider product page
Atlas Antibodies - HPA006550
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDE
AIYYFKANVFFKNYEIKNEADRTLIYITLYISECL
KKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLN
AIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVF
DPQNDKPSK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -