HPA006550

ARPC3 antibody from Sigma-Aldrich
ARC21, p21-Arc
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006550
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006550, RRID:AB_1854869
Product name
Anti-ARPC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006550
Antibody type
Polyclonal
Antigen
Actin-related protein 2/3 complex subunit 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDE
AIYYFKANVFFKNYEIKNEADRTLIYITLYISECL
KKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLN
AIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVF
DPQNDKPSK
Storage
-20C
Provider Type Product Number
- No reagents -