H00023166-M05

STAB1 antibody from Abnova Corporation
CLEVER-1, FEEL-1, FELE-1, FEX1, KIAA0246, SCARH2, STAB-1

Antibody data

Product number
H00023166-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023166-M05, RRID:AB_1714762
Product name
STAB1 monoclonal antibody (M05), clone 4G9
Provider product page
Abnova Corporation - H00023166-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant STAB1.
Antigen sequence
EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMV
GEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARC
DHFETRPLRLNTCSICGLEPPCPEGSQEQ
Isotype
IgG
Antibody clone number
4G9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -