HPA005434

STAB1 antibody from Atlas Antibodies
CLEVER-1, FEEL-1, FELE-1, FEX1, KIAA0246, SCARH2, STAB-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005434
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005434, RRID:AB_1080097
Product name
Anti-STAB1
Provider product page
Atlas Antibodies - HPA005434
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LEYKELKGDGPFTIFVPHADLMSNLSQDELARIRA
HRQLVFRYHVVGCRRLRSEDLLEQGYATALSGHPL
RFSEREGSIYLNDFARVVSSDHEAVNGILH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -