HPA005434

STAB1 antibody from Sigma-Aldrich
CLEVER-1, FEEL-1, FELE-1, FEX1, KIAA0246, STAB-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005434
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005434, RRID:AB_1080097
Product name
Anti-STAB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005434
Antibody type
Polyclonal
Antigen
Stabilin-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEYKELKGDGPFTIFVPHADLMSNLSQDELARIRA
HRQLVFRYHVVGCRRLRSEDLLEQGYATALSGHPL
RFSEREGSIYLNDFARVVSSDHEAVNGILH
Storage
-20C
Provider Type Product Number
- No reagents -