HPA023883

TBC1D8B antibody from Atlas Antibodies
FLJ20298, GRAMD8B, RP11-321G1.1

Antibody data

Product number
HPA023883
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023883, RRID:AB_1857794
Product name
Anti-TBC1D8B
Provider product page
Atlas Antibodies - HPA023883
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LHVSKPANEKEAESAKHSPEKGKGKIDIQAYLSQW
QDELFKKEENIKDLPRMNQSQFIQFSKTLYNLFHE
DPEEESLYQAIAVVTSLLLRMEEVGRKLHSPTSSA
KGFSGTVCGSGGPSEEKTGSHLEKDPCSFREEPQW
SFAFEQILA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.