HPA023883

TBC1D8B antibody from Sigma-Aldrich
FLJ20298, GRAMD8B, RP11-321G1.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023883
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023883, RRID:AB_1857794
Product name
Anti-TBC1D8B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023883
Antibody type
Polyclonal
Antigen
TBC1 domain family member 8B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHVSKPANEKEAESAKHSPEKGKGKIDIQAYLSQW
QDELFKKEENIKDLPRMNQSQFIQFSKTLYNLFHE
DPEEESLYQAIAVVTSLLLRMEEVGRKLHSPTSSA
KGFSGTVCGSGGPSEEKTGSHLEKDPCSFREEPQW
SFAFEQILA
Storage
-20C
Provider Type Product Number
- No reagents -