HPA010120

BMF antibody from Sigma-Aldrich
FLJ00065
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010120
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010120, RRID:AB_1845385
Product name
Anti-BMF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010120
Antibody type
Polyclonal
Antigen
Bcl-2-modifying factor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLD
CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPA
SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFP
AVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHR
LHVQQHQQNQ
Storage
-20C
Provider Type Product Number
- No reagents -