Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA036565 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA036565, RRID:AB_10673623
- Product name
- Anti-MATR3
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWE
EKRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYY
DRMDYEDDRLRDGERCRDD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mutations in the Matrin 3 gene cause familial amyotrophic lateral sclerosis
Johnson J, Pioro E, Boehringer A, Chia R, Feit H, Renton A, Pliner H, Abramzon Y, Marangi G, Winborn B, Gibbs J, Nalls M, Morgan S, Shoai M, Hardy J, Pittman A, Orrell R, Malaspina A, Sidle K, Fratta P, Harms M, Baloh R, Pestronk A, Weihl C, Rogaeva E, Zinman L, Drory V, Borghero G, Mora G, Calvo A, Rothstein J, Drepper C, Sendtner M, Singleton A, Taylor J, Cookson M, Restagno G, Sabatelli M, Bowser R, Chiò A, Traynor B
Nature Neuroscience 2014 March;17(5):664-666
Nature Neuroscience 2014 March;17(5):664-666
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line SH-SY5Y.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows moderate to strong nuclear positivity in lymphoid cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.
- Sample type
- HUMAN
