HPA022852

EFCAB5 antibody from Sigma-Aldrich
FLJ46247
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022852
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022852, RRID:AB_1848012
Product name
Anti-EFCAB5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022852
Antibody type
Polyclonal
Antigen
EF-hand calcium-binding domain-containing protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSTEPRLNKMEFTEYISSHIKDLKSEMFEELLKHL
CHSADEFREVIKADMRRQMFAELFLHCDHGKVGFL
DRQRTLALLELFYDHSSQMLRSLLRNPRQWPFIEF
EEINLTEL
Storage
-20C
Provider Type Product Number
- No reagents -