HPA028608

EFCAB5 antibody from MilliporeSigma / Merck KGaA
FLJ46247
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028608
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028608, RRID:AB_2097451
Product name
Anti-EFCAB5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028608
Antibody type
Polyclonal
Antigen
EF-hand calcium binding domain 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHIESLRNSARRKWLHQIQCAAETSGVSLEPVYSE
TFKALMQDAEAHGNKKISAHISLLEENLLLPEKGN
VLLRNVACTLDDAQFVLNRVLYRDMKGISFTVVDE
GKPIHVPQVQ
Storage
-20C
Provider Type Product Number
- No reagents -