Antibody data

Product number
H00025803-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025803-A01, RRID:AB_461817
Product name
SPDEF polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00025803-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant SPDEF.
Antigen sequence
MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGA
VGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPED
SSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSL
DLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKL
LNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAF
QELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWK
SAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCS
GQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFK
IEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKK
GIIRKPDISQRLVYQFVHPI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -