Antibody data

Product number
H00025803-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025803-M01, RRID:AB_519063
Product name
SPDEF monoclonal antibody (M01), clone 4A5
Provider product page
Abnova Corporation - H00025803-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SPDEF.
Antigen sequence
QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMV
VGEVLKDIETACKLLNITADPMDWSPSNVQKWLLW
TEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSP
LGGD
Isotype
IgG
Antibody clone number
4A5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -