HPA055707

SPDEF antibody from Atlas Antibodies
bA375E1.3, PDEF

Antibody data

Product number
HPA055707
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA055707, RRID:AB_2682894
Product name
Anti-SPDEF
Provider product page
Atlas Antibodies - HPA055707
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMV
VGEVLKDIETACKLLNITADPMDWSPSNVQKW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -