Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109117 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Proximal Sequence Element 1 (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SPDEF antibody: synthetic peptide directed towards the N terminal of human SPDEF.
- Description
- Purified on Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
AAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDM
LYPEDSSWAAKAPGA- Epitope
- N-Term
- Vial size
- 0.1 mg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references RUNX1 (AML-1) and RUNX2 (AML-3) cooperate with prostate-derived Ets factor to activate transcription from the PSA upstream regulatory region.
Fowler M, Borazanci E, McGhee L, Pylant SW, Williams BJ, Glass J, Davis JN, Meyers S
Journal of cellular biochemistry 2006 Jan 1;97(1):1-17
Journal of cellular biochemistry 2006 Jan 1;97(1):1-17
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human MCF7; WB Suggested Anti-SPDEF Antibody Titration: 2.5ug/ml. ELISA Titer: 1:12500. Positive Control: MCF7 cell lysate. SPDEF is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.; SPDEF antibody - N-terminal region (AP42057PU-N) in Human MCF7 cells using Western Blot