Antibody data

Product number
ABIN1109117
Provider
antibodies-online
Product name
anti-Proximal Sequence Element 1 (N-Term) antibody
Provider product page
antibodies-online - ABIN1109117
Antibody type
Polyclonal
Antigen
The immunogen for anti-SPDEF antibody: synthetic peptide directed towards the N terminal of human SPDEF.
Description
Purified on Protein A affinity column
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine
Host
Rabbit
Antigen sequence
AAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDM
LYPEDSSWAAKAPGA
Epitope
N-Term
Vial size
0.1 mg
Storage
Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
Handling
Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -