Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309625 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Proximal Sequence Element 1 (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SPDEF antibody: synthetic peptide directed towards the N terminal of human SPDEF
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
AAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDM
LYPED SSWAAKAPGA- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references RUNX1 (AML-1) and RUNX2 (AML-3) cooperate with prostate-derived Ets factor to activate transcription from the PSA upstream regulatory region.
Fowler M, Borazanci E, McGhee L, Pylant SW, Williams BJ, Glass J, Davis JN, Meyers S
Journal of cellular biochemistry 2006 Jan 1;97(1):1-17
Journal of cellular biochemistry 2006 Jan 1;97(1):1-17
No comments: Submit comment
No validations: Submit validation data