Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486951 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Proximal Sequence Element 1 (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SPDEF antibody: synthetic peptide directed towards the middle region of human SPDEF
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
ELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMK
ERTSP GAIHYCASTS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression characteristics of prostate-derived Ets factor support a role in breast and prostate cancer progression.
Sood AK, Saxena R, Groth J, Desouki MM, Cheewakriangkrai C, Rodabaugh KJ, Kasyapa CS, Geradts J
Human pathology 2007 Nov;38(11):1628-38
Human pathology 2007 Nov;38(11):1628-38
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting