HPA008455

MCL1 antibody from Sigma-Aldrich
BCL2L3, Mcl-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008455
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008455, RRID:AB_1079334
Product name
Anti-MCL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008455
Antibody type
Polyclonal
Antigen
Induced myeloid leukemia cell differentiation protein Mcl-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESG
NNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYL
REQATGAKDTKPMGRSGATSRKALETLRRVGDG
Storage
-20C
Provider Type Product Number
- No reagents -