H00009655-M01
antibody from Abnova Corporation
Targeting: SOCS5
CIS6, Cish5, CISH6, KIAA0671, SOCS-5
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009655-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009655-M01, RRID:AB_489794
- Product name
- SOCS5 monoclonal antibody (M01), clone 2D1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SOCS5.
- Antigen sequence
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSN
RCLSVKEKNISIGDSTPQQQSSPLRENIALQLGLS
PSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPG
TRLAR- Isotype
- IgG
- Antibody clone number
- 2D1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SOCS5 monoclonal antibody (M01), clone 2D1 Western Blot analysis of SOCS5 expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SOCS5 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SOCS5 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol