HPA002544

CNIH1 antibody from Atlas Antibodies
CNIH, CNIL, TGAM77
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002544
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002544, RRID:AB_2081856
Product name
Anti-CNIH1
Provider product page
Atlas Antibodies - HPA002544
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYC
QKEGWCKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -