HPA002544

CNIH1 antibody from Sigma-Aldrich
CNIH, CNIL, TGAM77
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002544
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002544, RRID:AB_2081856
Product name
Anti-CNIH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002544
Antibody type
Polyclonal
Antigen
Cornichon homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYC
QKEGWCKL
Storage
-20C
Provider Type Product Number
- No reagents -