HPA008689

CPA3 antibody from Atlas Antibodies

Eligible for validation within the Antibodypedia Validation Initiative

SELECT THIS
ANTIBODY

PERFORM KNOCKDOWN
OR KNOCKOUT

SUBMIT POSITIVE
RESULTS

GET
REWARDED

Antibody data

Submit

Validation data

Product number: HPA008689
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA008689, RRID:AB_1233677
Product name: Anti-CPA3
Provider product page: Atlas Antibodies - HPA008689
Antibody type: Polyclonal
Description: Affinity purified using the PrEST antigen as affinity ligand
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYR GSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQ MLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYE TRYIYGPIESTIYPISGSSL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Provider	Type	Product Number
- No reagents -

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human nasopharynx shows distinct positivity in subsets of inflammatory cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cervix, uterine shows strong cytoplasmic positivity in mast cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in mast cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows strong cytoplasmic positivity in mast cells.
Sample type: HUMAN

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human rectum and skeletal muscle tissues using Anti-CPA3 antibody. Corresponding CPA3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cervix, uterine and skeletal muscle tissues using HPA008689 antibody. Corresponding CPA3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cervix, uterine, skeletal muscle, skin and small intestine using Anti-CPA3 antibody HPA008689 (A) shows similar protein distribution across tissues to independent antibody HPA006479 (B).
Sample type: HUMAN
Antibody #2 product nr: HPA006479
Antibody provider: Atlas Antibodies
Independent Antibody Method: ANTIBODY