HPA006479

CPA3 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006479
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006479, RRID:AB_1078396
Product name
Anti-CPA3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006479
Antibody type
Polyclonal
Antigen
Mast cell carboxypeptidase A precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYP
GATHHVAANMMVDFRVSEKESQAIQSALDQNKMHY
EILIHDLQEEIEKQFDVKEDIPGRHSYAKYNNWEK
IVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKI
GEKNER
Storage
-20C
Provider Type Product Number
- No reagents -