HPA008689

CPA3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008689
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008689, RRID:AB_1846009
Product name
Anti-CPA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008689
Antibody type
Polyclonal
Antigen
Mast cell carboxypeptidase A precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYR
GSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQ
MLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYE
TRYIYGPIESTIYPISGSSL
Storage
-20C
Provider Type Product Number
- No reagents -