PAB29886
antibody from Abnova Corporation
Targeting: KCNQ2
BFNC, EBN, EBN1, ENB1, HNSPC, KCNA11, Kv7.2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29886 - Provider product page

- Provider
- Abnova Corporation
- Product name
- KCNQ2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial synthetic protein of human KCNQ2.
- Antigen sequence
GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGS
VVYAHSKELVTAWYI- Isotype
- IgG
- Storage
- Store at 4°C for up to one week. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of HepG2 cell lysate with KCNQ2 polyclonal antibody (Cat # PAB29886).