HPA016642

KCNQ2 antibody from Sigma-Aldrich
BFNC, EBN, EBN1, ENB1, HNSPC, KCNA11, Kv7.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016642
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016642, RRID:AB_1855555
Product name
Anti-KCNQ2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016642
Antibody type
Polyclonal
Antigen
Potassium voltage-gated channel subfamily KQT member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FYATNLSRTDLHSTWQYYERTVTVPMYRLIPPLNQ
LELLRNLKSKSGLAFRKDPPPEPSPSQKVSLKDRV
FSSPRGVAAKGKGSPQAQTVRRSPSADQSLEDSPS
KVPKSWSFGDRSRARQAFRIKGAASRQNSEEA
Storage
-20C
Provider Type Product Number
- No reagents -