Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB15697 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB15697, RRID:AB_10678998
- Product name
- Kif17 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant Kif17.
- Antigen sequence
LGGHFGDKVGREELLSACPFSVVQLRAAEVEIKDL
QSEFQLEKIDYLATIRRQERDSMLFQQLLEQVQPL
IRRDCNYSNLEKIRRESSWDEDNGFWKIPDPIILK
TSLPVAVPTGTQNKPARKTSAVDSGEPHMQEEDRY
KLMLSRSDSENIASNYFRSKRASQILSTDPMKSLT
YHNSPPGLNSSLSNNSALPPTQTPEMPQPRPFRLE
SLDIPFSKAKRKKSKNSFGGEPL- Storage
- Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
The kinesin KIF17b and RNA-binding protein TB-RBP transport specific cAMP-responsive element modulator-regulated mRNAs in male germ cells.
Koga H, Yuasa S, Nagase T, Shimada K, Nagano M, Imai K, Ohara R, Nakajima D, Murakami M, Kawai M, Miki F, Magae J, Inamoto S, Okazaki N, Ohara O
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Hara Y, Shimada K, Kohga H, Ohara O, Koga H
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36
The kinesin KIF17b and RNA-binding protein TB-RBP transport specific cAMP-responsive element modulator-regulated mRNAs in male germ cells.
Chennathukuzhi V, Morales CR, El-Alfy M, Hecht NB
Proceedings of the National Academy of Sciences of the United States of America 2003 Dec 23;100(26):15566-71
Proceedings of the National Academy of Sciences of the United States of America 2003 Dec 23;100(26):15566-71
No comments: Submit comment
No validations: Submit validation data